IthaID: 3325



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 144 AAG>AGG [Lys>Arg] HGVS Name: HBB:c.434A>G
Hb Name: Hb Heze Protein Info: β144(HC1)Lys>Arg

Context nucleotide sequence:
TGGCTGGTGTGGCTAATGCCCTGGCCCACA [A/G] GTATCACTAAGCTCGCTTTCTTGCTGTCCA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHRYH

Also known as:

Comments: The mutation associates with a mild β-thal phenotype in the heterozygote state, but leads to a β-thal intermedia (β-TI) phenotype when interacting with β0-thal. The lysine at β144 is located at the HC1 position, in the central pocket near to the C-terminal of the β-globin chain.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 72008
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Li Y, Yan JM, Zhou JY, Lu YC, Li DZ, Combination of Hb Heze [β144(HC1)Lys→Arg; HBB: c.434A>G] and β-Thalassemia in a Chinese Patient with β-Thalassemia Intermedia., Hemoglobin , 41(1), 47-49, 2017 PubMed
Created on 2018-03-05 18:24:44, Last reviewed on 2019-04-08 11:15:20 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.