IthaID: 192


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 90 GAG>TAG HGVS Name: HBB:c.271G>T
Hb Name: N/A Protein Info: β 90(F6) Glu>Stop

Context nucleotide sequence:
CAAGGGCACCTTTGCCACACTGAGT [A/G/T] AGCTGCACTGTGACAAGCTGCACGT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSX

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:β0
Associated Phenotypes: Haemolytic anaemia [HP:0001878]
Ineffective erythropoiesis [HP:0010972]

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70995
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Nonsense codon (Translation)
Ethnic Origin: Japanese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Frequencies

Publications / Origin

  1. Fucharoen S, Katsube T, Fucharoen G, Sawada H, Oishi H, Katsuno M, Nishimura J, Motomura S, Miura Y, Fukumaki Y, Molecular heterogeneity of beta-thalassaemia in the Japanese: identification of two novel mutations., British journal of haematology, 74(1), 101-7, 1990
  2. Hattori Y, Yamamoto K, Yamashiro Y, Ohba Y, Miyamura S, Yamamoto K, Matsuno Y, Morishita M, Miyaji T, Era T, Three beta-thalassemia mutations in the Japanese: IVS-II-1 (G----A), IVS-II-848 (C----G), and codon 90 (GAG----TAG)., Hemoglobin, 16(1), 93-7, 1992
  3. Aldemir O, Izmirli M, Kaya H, The Spectrum of β-Thalassemia Mutations in Hatay, Turkey: Reporting Three New Mutations., Hemoglobin , 38(5), 325-8, 2014
Created on 2010-06-16 16:13:15, Last reviewed on 2014-10-09 16:29:00 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.