IthaID: 3598


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 93/94 (-TG) [Cys>STOP] HGVS Name: HBD:c.282_283delTG
Hb Name: N/A Protein Info: p.Cys93Stop

Context nucleotide sequence:
TTTTTCTCAGCTGAGTGAGCTGCACTG [TG/-] ACAAGCTGCACGTGGATCCTGA (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHX

Also known as:

Comments: Found in a 38-years old pregnant Spanish woman with normal clinical presentation. The 2-bp deletion creates a premature stop codon at the 93 amino acid. Hb X was not visible using HPLC but HbA2 was slightly low (1.3%).

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: N/A
Allele Phenotype:δ0
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63592
Size: 2 bp
Located at: δ
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Nonsense codon (Translation)
Ethnic Origin: Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Created on 2020-06-30 15:04:19, Last reviewed on 2020-06-30 15:06:06 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.