IthaID: 3991
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 10 GTC>GAC [Val>Asp] | HGVS Name: | HBA2:c.32T>A |
Hb Name: | Hb Chumphae | Protein Info: | N/A |
Context nucleotide sequence:
GTCTCCTGCCGACAAGACCAACG [T>A] CAAGGCCGCCTGGGGTAAGGTCGG (Strand: +)
Protein sequence:
MVLSPADKTNDKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVHDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as:
Comments: The mutation was detected in a 2-week-old Thai boy during investigating the cause of anemia. DNA analysis showed the interaction of α0-thalassemia (SEA deletion) and Hb Chumphae. CBC revealed RBC 3.19x10^12/L, Hb 7.7 g/dL, Hct 7.7 %, MCV 76.8 fL, MCH 24.0 pg, MCHC 31.2 g/dL, RDW 28.0%. Hb analysis showed 39.6% Hb A, 29.5% Hb F, 29.4% Hb Bart’s, and 1.5% Hb H.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
No available links
Phenotype
Hemoglobinopathy Group: | Thalassaemia |
---|---|
Hemoglobinopathy Subgroup: | α-thalassaemia |
Allele Phenotype: | α⁺ |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 33807 |
Size: | 1 bp |
Located at: | α2 |
Specific Location: | Exon 1 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | N/A |
Ethnic Origin: | Thai |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Singha, Kritsada | 2022-12-12 | First report. |
2 | Fucharoen, Supan | 2022-12-12 | First report. |
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2022-12-13 14:23:59 | The IthaGenes Curation Team | Created |
2 | 2022-12-13 14:44:40 | The IthaGenes Curation Team | Reviewed. Microattribution added. |
3 | 2022-12-14 15:38:22 | The IthaGenes Curation Team | Reviewed. Text additions. |