IthaID: 776


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 140 TAC>CAC [Tyr>His] HGVS Name: HBA1:c.421T>C | HBA2:c.421T>C
Hb Name: Hb Ethiopia Protein Info: α2 or α1 140(HC2) Tyr>His

Context nucleotide sequence:
TGTGAGCACCGTGCTGACCTCCAAA [C/T] ACCGTTAAGCTGGAGCCTCGGTGGC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKHR

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34455 or 38266
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Ethiopian, French
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Webber BB, Wilson JB, Gu LH, Huisman TH, Hb Ethiopia or alpha 2(140)(HC2)Tyr----His beta 2., Hemoglobin , 16(5), 441-3, 1992
  2. Wajcman H, Kister J, Marden M, Lahary A, Monconduit M, Galacteros F, Hemoglobin Rouen (alpha-140 (HC2) Tyr-->His): alteration of the alpha-chain C-terminal region and moderate increase in oxygen affinity., Biochim. Biophys. Acta , 1180(1), 53-7, 1992
Created on 2010-06-16 16:13:16, Last reviewed on 2024-02-13 12:18:30 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.