IthaID: 1068


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 80 AAC>AAG [Asn>Lys] HGVS Name: HBB:c.243C>G
Hb Name: Hb G-Szuhu Protein Info: β 80(EF4) Asn>Lys

Context nucleotide sequence:
GTGATGGCCTGGCTCACCTGGACAA [C>G] CTCAAGGGCACCTTTGCCACACTGA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDKLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as: Hb Gifu

Comments: Initially reported by protein analysis as an asparagine [AAC] to lysine [AAA or AAG] change at position β80, which is in the nonhelical EF section of the β-chain, in families of different origins. Later reported as a c.243C>G change by DNA analysis. Asp (neutral) to Lys (positive charge) substitution changes the charge of the Hb molecule. The electrophoretic mobility is similar to the other variant Hb of the D and G group. It can result in falsely low HbA1c concentration readings when using HPLC. It does not disturb the oxygenation/deoxygenation function, nor the stability of the Hb molecule. Its presence does not appear to cause any clinical or hematological abnormality; the Hb GSzuhu/β0-thalassemia condition apparently is more or less comparable to a simple β0-thalassemia. The same Hb variant is also described as Hb G Gifu in Japan.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70967
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Chinese, Turkish Jews, English, Spanish, Japanese, Sinhalese, Sicilian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
199Hb G-SzuhuβD-10Dual Kit Program32.24.17Clinically normal. Elutes in HbS window. [PDF]
200Hb G-SzuhuβVARIANTβ-thal Short Program37.74.54Clinically normal. [PDF]
201Hb G-SzuhuβVARIANT IIβ-thal Short Program34.52.13[PDF]
202Hb G-SzuhuβVARIANT IIDual Kit Program3.23.017[PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Blackwell RQ, Yang HJ, Wang CC, Hemoglobin G Szuhu: beta80 Asn replaced by Lys., Biochimica et biophysica acta, 188(1), 59-64, 1969
  2. Matsutomo K, Miyaji T, Iuchi I, Ueda S, Shibata S, Hb Gifu (beta 80 Asn-Lys), a new slow moving hemoglobin detected from two families of Japanese., Nippon Ketsueki Gakkai Zasshi , 34(4), 479-83, 1971
  3. Kaufman S, Leiba H, Clejan L, Wallis K, Lorkin PA, Lehmann H, Haemoglobin G-Szuhu, beta80 Asn-Lys, in the homozygous state in a patient with abetalipoproteinaemia., Hum. Hered. , 25(1), 60-8, 1975
  4. Welch SG, Haemoglobin G Szuhu beta 80 asn leads to lys in an English family., Humangenetik, 28(4), 331-3, 1975
  5. Romero C, Fernandez Fuertes I, Quintana A, Blanco L, Navarro JL, Wilson JB, Huisman TH, Hb G-Szuhu or alpha 2 beta 2(80)(EF4)Asn----Lys, in combination with beta zero-thalassemia in a Spanish family., Hemoglobin, 9(5), 535-9, 1985
  6. Schillirò G, Russo-Mancuso G, Dibenedetto SP, Samperi P, di Cataldo A, Ragusa R, Testa R, Six rare hemoglobin variants found in Sicily., Hemoglobin, 15(5), 431-7, 1991
  7. Moriwaki Y, Yamamoto T, Shibutani Y, Harano T, Takahashi S, Hada T, Abnormal haemoglobins, Hb Takamatsu and Hb G-Szuhu, detected during the analysis of glycated haemoglobin (HbA1C) by high performance liquid chromatography., J Clin Pathol, 53(11), 854-7, 2000
  8. Perera PS, Silva I, Hapugoda M, Wickramarathne MN, Wijesiriwardena I, Efremov DG, Fisher CA, Weatherall DJ, Premawardhena A, Rare hemoglobin variants: Hb G-Szuhu (HBB: c.243C>G), Hb G-Coushatta (HBB: c.68A>C) and Hb Mizuho (HBB: c.206T>C) in Sri Lankan families., Hemoglobin , 39(1), 62-5, 2015
Created on 2010-06-16 16:13:16, Last reviewed on 2023-05-10 10:21:00 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.