
IthaID: 1104
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 92 CAC>TAC | HGVS Name: | HBB:c.277C>T |
Hb Name: | Hb M-Milwaukee-2 | Protein Info: | β 92(F8) His>Tyr |
Context nucleotide sequence:
CACCTTTGCCACACTGAGTGAGCTG [A/C/G/T] ACTGTGACAAGCTGCACGTGGATCC (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELYCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as: Hb M-Akita, Hb M-Hyde Park
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | Methemoglobinaemia |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 71001 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Worldwide |
Molecular mechanism: | Altered heme pocket |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
---|---|---|---|---|---|---|---|---|---|
589 | Hb M-Milwaukee-2 | β | D-10 | Dual Kit Program | 31.6 | 4.71 | Congenital methemoglobinemia. | [PDF] | |
590 | Hb M-Milwaukee-2 | β | VARIANT | β-thal Short Program | 34.9 | 5.08 | Congenital methemoglobinemia. | [PDF] | |
591 | Hb M-Milwaukee-2 | β | VARIANT II | β-thal Short Program | 34.1 | 5.15 | Congenital methemoglobinemia. | [PDF] | |
592 | Hb M-Milwaukee-2 | β | VARIANT II | Dual Kit Program | 31.1 | 4.435 | Congenital methemoglobinemia. | [PDF] |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Publications / Origin
- , , , 0000
- Ranney HM, Nagel RL, Heller P, Udem L, Oxygen equilibrium of hemoglobin M-Hyde Park., Biochim. Biophys. Acta , 160(1), 112-5, 1968
- Shibata S, Miyaji T, Iuchi I, Oba Y, Yamamoto K, Amino acid substitution in hemoglobin Makita., J. Biochem. , 63(2), 193-8, 1968
- Stamatoyannopoulos G, Nute PE, Giblett E, Detter J, Chard R, Haemoglobin M Hyde Park occurring as a fresh mutation: diagnostic, structural, and genetic considerations., J. Med. Genet. , 13(2), 142-7, 1976
- Hutt PJ, Pisciotta AV, Fairbanks VF, Thibodeau SN, Green MM, DNA sequence analysis proves Hb M-Milwaukee-2 is due to beta-globin gene codon 92 (CAC-->TAC), the presumed mutation of Hb M-Hyde Park and Hb M-Akita., Hemoglobin, 22(1), 1-10, 1998
Created on 2010-06-16 16:13:16,
Last reviewed on 2022-06-03 12:02:38 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:16 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2015-12-03 14:42:32 | The IthaGenes Curation Team | Reviewed. References added. Phenotype updated. |
4 | 2022-06-03 12:02:38 | The IthaGenes Curation Team | Reviewed. Reference corrected. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2023-03-22 16:46:31