IthaID: 1151

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 102 AAC>CAC [Asn>His] HGVS Name: HBB:c.307A>C
Hb Name: Hb Canebiere Protein Info: β 102(G4) Asn>His
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGACAAGCTGCACGTGGATCCTGAG [A/C/T] ACTTCAGGGTGAGTCTATGGGACGC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPEHFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71031
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: North African
Molecular mechanism: Altered α1β1 interface
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Thuret I, Mely L, Kister J, Kiger L, Merono F, Badier M, Badens C, Association of HbS and a new low oxygen affinity variant, Hb Canebière, [beta102(G4)Asn->Lys] in a healthy child., Haematologica, 89(9), ECR31, 2004
  2. Froelund U, Sandbakken E, Szecsi P, Birgens H, Further studies on Hb Canebière [β12(G4)Asn→His], a low affinity hemoglobin variant., Hemoglobin , 34(5), 495-9, 2010
Created on 2010-06-16 16:13:16, Last reviewed on 2014-06-04 09:26:44 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.