IthaID: 1445

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 92 CAC>TAC HGVS Name: HBG2:c.277C>T
Hb Name: Hb F-M-Fort Ripley Protein Info: Gγ 92(F8) His>Tyr
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CACCTTTGCCCAGCTGAGTGAACTG [C/T] ACTGTGACAAGCTGCATGTGGATCC (Strand: -)

Protein sequence:
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELYCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: γ-chain variant
Allele Phenotype:Methemoglobinaemia
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 43286
Size: 1 bp
Located at:
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: American, Canadian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Priest JR, Watterson J, Jones RT, Faassen AE, Hedlund BE, Mutant fetal hemoglobin causing cyanosis in a newborn., Pediatrics, 83(5), 734-6, 1989
  2. Molchanova TP, Wilson JB, Gu LH, Hain RD, Chang LS, Poon AO, Huisman TH, A second observation of the fetal methemoglobin variant Hb F-M-Fort Ripley or alpha 2G gamma 2(92)(F8)His----Tyr., Hemoglobin, 16(5), 389-98, 1992
Created on 2010-06-16 16:13:17, Last reviewed on 2013-10-15 17:00:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.