
IthaID: 2319
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A | 
|---|---|---|---|
| Common Name: | CD 38 ACC>GCC [Thr>Ala] | HGVS Name: | HBA1:c.115A>G | HBA2:c.115A>G | 
| Hb Name: | Hb Beaconsfield | Protein Info: | α1 or α2 38(C3) Thr>Ala | 
| Also known as: | 
We follow the 
						 
							HGVS sequence variant nomenclature
						
						and
						 
							 IUPAC standards.
						
					
					
					
Context nucleotide sequence:
CCGCAGGATGTTCCTGTCCTTCCCC [A/G] CCACCAAGACCTACTTCCCGCACTT  (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPATKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy | 
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant | 
| Allele Phenotype: | N/A | 
| Stability: | N/A | 
| Oxygen Affinity: | N/A | 
| Associated Phenotypes: | N/A | 
Location
| Chromosome: | 16 | 
|---|---|
| Locus: | NG_000006.1 | 
| Locus Location: | 34007 or 37811 | 
| Size: | 1 bp or 1 bp | 
| Located at: | α1 or α2 | 
| Specific Location: | Exon 2 | 
Other details
| Type of Mutation: | Point-Mutation(Substitution) | 
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) | 
| Ethnic Origin: | English | 
| Molecular mechanism: | N/A | 
| Inheritance: | Recessive | 
| DNA Sequence Determined: | No | 
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
					Created on 2014-01-10 14:33:43,
					Last reviewed on 2014-04-17 11:02:42					(Show full history)
				
				
			
 Disclaimer: The information on this website is provided as an information resource only
    and must not to be used as a substitute for professional diagnosis and treatment.
    The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
    diagnosis or any other information, services or products that an individual obtains through this website.