IthaID: 2513
Names and Sequences
| Functionality: | Disease modifying mutation | Pathogenicity: | N/A | 
|---|---|---|---|
| Common Name: | rs483352839 | HGVS Name: | NG_013087.1:g.7252G>A | 
We follow the 
						 
							HGVS sequence variant nomenclature
						
						and
						 
							 IUPAC standards.
						
					
					
					
Context nucleotide sequence:
CACACGGGGCAGCGCCCCTTCCGCT [G/A] CCAGCTCTGCCCACGTGCTTTTTCG  (Strand: -)
Protein sequence:
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRYQLCPRAFSRSDHLALHMKRHL
Comments: Found as a heterozygote. Associated with borderline HbA2 levels and slightly elevated HbF levels in the normal Chinese population. Found in Chinese α-thalassaemia carriers with HbF levels of ≥1%.
External Links
Phenotype
| Allele Phenotype (Cis): | N/A | 
|---|---|
| Allele Phenotype (Trans): | Increased expression for Aγ or Gγ | 
| Associated Phenotypes: | Hb F levels [HP:0011904] [OMIM:141749] Increased Hb A2 levels [HP:0045048] | 
Location
| Chromosome: | 19 | 
|---|---|
| Locus: | NG_013087.1 | 
| Locus Location: | 7252 | 
| Size: | 1 bp | 
| Located at: | KLF1 | 
| Specific Location: | Exon 3 | 
Other details
| Type of Mutation: | Point-Mutation(Substitution) | 
|---|---|
| Effect on Gene/Protein Function: | N/A | 
| Ethnic Origin: | Chinese | 
| Molecular mechanism: | N/A | 
| Inheritance: | Quantitative trait | 
| DNA Sequence Determined: | Yes | 
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
- Lou JW, Li DZ, Zhang Y, He Y, Sun MN, Ye WL, Liu YH, Delineation of the molecular basis of borderline hemoglobin A2 in Chinese individuals., Blood Cells Mol. Dis. , 2014 PubMed
- Liu D, Zhang X, Yu L, Cai R, Ma X, Zheng C, Zhou Y, Liu Q, Wei X, Lin L, Yan T, Huang J, Mohandas N, An X, Xu X, Erythroid Krüppel-like factor mutations are relatively more common in a thalassemia endemic region and ameliorate the clinical and hematological severity of β-thalassemia., Blood , 2014 PubMed
- Jiang F, Qu YX, Chen GL, Li J, Zhou JY, Zuo LD, Liao C, Li DZ, KFL1 Gene Variants in α-Thalassemia Individuals with Increased Fetal Hemoglobin in a Chinese Population., Hemoglobin, 2018 PubMed
