IthaID: 2556

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 113 GTT>ATT [Val>Ile] HGVS Name: HBG1:c.340G>A
Hb Name: Hb F-Sykesville MD Protein Info: Aγ 113(G15) Val>Ile
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GCTCCTGGGAAATGTGCTGGTGACC [G/A] TTTTGGCAATCCATTTCGGCAAAGA (Strand: -)

Protein sequence:
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTILAIHFGKEFTPEVQASWQKMVTAVASALSSRYH

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: γ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 49153
Size: 1 bp
Located at:
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: American
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Patel N, Fixler J, Unguru Y, Kutlar A, Kutlar F, A new Aγ-globin chain variant: Hb F-Sykesville MD [Aγ113(G15)Val → Ile; HBG1: c.340G>A] detected in a Caucasian baby., Hemoglobin , 39(1), 52-4, 2015
Created on 2015-06-16 17:16:45, Last reviewed on 2019-04-08 11:27:35 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.