IthaID: 3271

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 119 CCT>GCT [Pro>Ala] HGVS Name: HBA2:c.358C>G
Hb Name: Hb Arcadia Protein Info: α2 119(H2) Pro>Ala
Also known as: Hb Lakeview Terrace

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGGCCGCCCACCTCCCCGCCGAGTTCACC [C/G] CTGCGGTGCACGCCTCCCTGGACAAGTTC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTAAVHASLDKFLASVSTVLTSKYR

Comments: Co-inherited with SEA deletion, red cell indices are consistent with this finding. HPLC findings, appears as shoulder of Hb A peak (Primus Resolution). Recently, the variant reported in compound heterozygosity with Hb D-Los Angeles [IthaID: 1217] in a 11-month old infant presented with Hb 12.1 g/dL, MCH 24.1 pg, MCHC 33.8 g/dL, MCV 71.3 fL and RBC 5.02 10^12/L.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34392
Size: 1 bp
Located at: α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: N/A
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Daniel, Yvonne2017-10-26First report.
2Monteiro, Daniel2017-10-26First report.
Created on 2017-10-26 14:31:13, Last reviewed on 2021-02-02 16:37:18 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.