IthaID: 3315

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 56 GGC>GAC [Gly>Asp] HGVS Name: HBD:c.170G>A
Hb Name: Hb A2-Shah Alam Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMDNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Comments: HBD:c.170G>A substitutes glycine with aspartic (missense). The index was identified with heterozygous β+ IVS 1-5 (G>C) inherited from the father. His HbA2 and HbF was 2.5% and 3.0%, respectively. The HBD was inherited from the mother. His mother’s HbA2 was 1.4%. CE showed additional fraction at Zone 6 (mother 1.0%, child 1.2%). Possible HBA and HBB variants were ruled out by sequencing.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63480
Size: 1 bp
Located at: δ
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Malaysian Malay
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Syahzuwan, Hassan2018-02-14First report.
Created on 2018-02-14 17:22:43, Last reviewed on 2018-02-14 17:37:04 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.