
IthaID: 3325
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 144 AAG>AGG [Lys>Arg] | HGVS Name: | HBB:c.434A>G |
Hb Name: | Hb Heze | Protein Info: | β144(HC1)Lys>Arg |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
TGGCTGGTGTGGCTAATGCCCTGGCCCACA [A/G] GTATCACTAAGCTCGCTTTCTTGCTGTCCA (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHRYH
Comments: The mutation associates with a mild β-thal phenotype in the heterozygote state, but leads to a β-thal intermedia (β-TI) phenotype when interacting with β0-thal. The lysine at β144 is located at the HC1 position, in the central pocket near to the C-terminal of the β-globin chain.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 72008 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Chinese |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- Li Y, Yan JM, Zhou JY, Lu YC, Li DZ, Combination of Hb Heze [β144(HC1)Lys→Arg; HBB: c.434A>G] and β-Thalassemia in a Chinese Patient with β-Thalassemia Intermedia., Hemoglobin , 41(1), 47-49, 2017
Created on 2018-03-05 18:24:44,
Last reviewed on 2019-04-08 11:15:20 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.