IthaID: 3368

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 54 GTT>ATT [Val>Ile] HGVS Name: HBB:c.163G>A
Hb Name: Hb Askew Protein Info: β 54(D5) Val>Ile
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGGGGATCTGTCCACTCCTGATGCT [G/A] TTATGGGCAACCCTAAGGTGAAGG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAIMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Comments: During antenatal screening, a sample with abnormal ce-HPLC findings and positive sickle solubility testing was analyzed by ESI-MS. Three variants were identified: Hb Stanleyville II (α78Asn>Lys), Hb S (β6Glu>Val), and a third β-chain variant showing a +14 Da mass shift. Tryptic digestion and low-energy CID localized the substitution to β54, consistent with either Val>Leu or Val>Ile. Subsequent hot electron capture dissociation (HECD) demonstrated the diagnostic z₆ -29 Da ion, confirming the substitution as β54Val>Ile (and not Leu). This was further validated using synthetic peptides. No DNA sequencing was performed; the nucleotide change was inferred from the confirmed amino acid substitution.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70887
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: English
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Williams JP, Creese AJ, Roper DR, Green BN, Cooper HJ, Hot electron capture dissociation distinguishes leucine from isoleucine in a novel hemoglobin variant, Hb Askew, beta54(D5)Val-->Ile., J. Am. Soc. Mass Spectrom., 20(9), 1707-13, 2009
Created on 2019-04-05 12:05:35, Last reviewed on 2026-02-13 09:37:19 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.