IthaID: 3406

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 69 GGT>GAT [Gly>Asp] HGVS Name: HBD:c.209G>A
Hb Name: Hb A2-Gebenstorf Protein Info: δ 69(E13) Gly>Asp
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GGCTCATGGCAAGAAGGTGCTAG [G/A] TGCCTTTAGTGATGGCCTGGCT (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLDAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Comments: The δ-globin variant was found in a heterozygous state in a mother and her daughter of Swiss origin. The mother presented with normal blood counts and reduced HbA2 level (Hb 14.9 g/dL, MCV 89.9 fL, MCH 29.5 pg, HbA2 1.2%, HbF 0.5%). The daughter was also carrier of a deletional (εγ)δβ0-thal [ithaID=3606], presenting with a beta-thalassaemia minor phenotype (Hb 10.6 g/dL, MCV 61.0 fL, MCH 18.2 pg, HbA2 0%, HbF 0.7%). Variant was detected by HPLC; it is expected to move faster than HbA2 and thus to co-migrate with HbA.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63519
Size: 1 bp
Located at: δ
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Swiss
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Saller E, Knijnenburg J, Harteveld CL, Dutly F, A Woman with Missing Hb A Due to a Novel (εγ)δβ-Thalassemia and a Novel δ-Globin Variant Hb A-Gebenstorf (: c.209G>A)., Hemoglobin, 44(3), 214-217, 2020
Created on 2019-04-12 13:48:54, Last reviewed on 2020-08-06 16:38:37 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.