
IthaID: 3608
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A | 
|---|---|---|---|
| Common Name: | CD 50 (TCT>TGT);CD 75(ATA>ACA) | HGVS Name: | HBG2:c.[152C>G;227T>C] | 
| Hb Name: | Hb F-Madrid | Protein Info: | Gγ 50(D1) Ser>Cys;Gγ 75(E19) Ile>Thr | 
| Also known as: | 
We follow the 
						 
							HGVS sequence variant nomenclature
						
						and
						 
							 IUPAC standards.
						
					
					
					
Protein sequence:
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSCASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Comments: The structural hemoglobin variant of Gγ with two amino acid replacements in cis found in the umbilical cord blood of a neonate in Madrid. The neonate born after a normal 40-week gestation and the main abnormal feature was a decreased MCV of 76 fl, at 1.5 years old. The neonate also carried the –α3.7 deletion.
External Links
No available links
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy | 
|---|---|
| Hemoglobinopathy Subgroup: | γ-chain variant | 
| Allele Phenotype: | N/A | 
| Stability: | N/A | 
| Oxygen Affinity: | N/A | 
| Associated Phenotypes: | N/A | 
Location
| Chromosome: | 11 | 
|---|---|
| Locus: | NG_000007.3 | 
| Locus Location: | 43161 | 
| Size: | 1 bp | 
| Located at: | Gγ | 
| Specific Location: | Exon 2 | 
Other details
| Type of Mutation: | Point-Mutation(Substitution) | 
|---|---|
| Effect on Gene/Protein Function: | N/A | 
| Ethnic Origin: | Spanish | 
| Molecular mechanism: | N/A | 
| Inheritance: | Recessive | 
| DNA Sequence Determined: | Yes | 
In silico pathogenicity prediction
Publications / Origin
- Hojas R, Villegas A, Ropero P, Valverde F, Nogales A, González FA, José C, Villar L, García C, Two new mutations in cis on (G)gamma chain of fetal hemoglobin: Hb F-Madrid [G gamma 50(D1)Ser-->Cys] and [G gamma 75(E19)Ile-->Thr]., Ann. Hematol., 82(3), 181-3, 2003
 
					Created on 2020-08-07 14:14:11,
					Last reviewed on 					(Show full history)
				
				
			
 Disclaimer: The information on this website is provided as an information resource only
    and must not to be used as a substitute for professional diagnosis and treatment.
    The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
    diagnosis or any other information, services or products that an individual obtains through this website.