IthaID: 4013


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 93 TGT>TGG [Cys>Trp] HGVS Name: HBD:c.282T>G
Hb Name: Hb A2-Pontedera Protein Info: delta 93(F9) Cys>Trp

Context nucleotide sequence:
TTTTTCTCAGCTGAGTGAGCTGCACTG [T>G] GACAAGCTGCACGTGGATCCTGA (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHWDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found in a heterozygous state in a 36-year-old Moroccan woman with normal laboratory findings and clinical image. Normochromic, normocytosis with Hb A2+Hb A2-X 2.0 % of total Hb. HbA2-Pontedera is detected by capillary electrophoresis, producing a slight shouldering of Hb A2 in a more anodic position on the Capi 3 Hemoglobin kit.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63592
Size: 1 bp
Located at: δ
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Moroccan
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Coviello, Domenico2023-01-30First report.
2Mogni, Massimo2023-01-30First report.
3Maffei, Massimo2023-01-30First report.
Created on 2023-01-31 10:53:50, Last reviewed on 2023-03-13 15:12:32 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.