IthaID: 4105

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD112 TGT>TCT [Cys>Ser] HGVS Name: HBB:c.338G>C
Hb Name: Hb Jiangxi Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CAGCTCCTGGGCAACGTGCTGGTCT [G>C] TGTGCTGGCCCATCACTTTGGCAAA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVSVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Comments: The c.338G>C variant (Hb Jiangxi) is a missense mutation in the HBB gene, resulting in the substitution of cytosine (TGT) with serine (TCT) at position β112(G14). Initially reported in a heterozygous state in a 29-year-old female from China, this variant was associated with normal hematological indices (Hb 116 g/L, MCV 88.2 fL, MCH 29.7 pg, RBC 3.91E12/L) and hemoglobin fractions of HbA 95.9%, HbF 1.1%, and HbA2 3.0% as determined by capillary electrophoresis (CE). The abnormal hemoglobin variant could not be separated by CE electrophoresis (Capillarys 3 TERA) or HPLC (Bio-Rad D-100) but was detected using MALDI-TOF MS.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71912
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Xu, Anping2024-07-24First report.
Created on 2024-07-25 13:57:56, Last reviewed on 2024-07-25 14:01:03 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.