IthaID: 4112

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 38 ACC>GCC [Thr>Ala] HGVS Name: HBB:c.115A>G
Hb Name: Hb Oviedo Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TAGGCTGCTGGTGGTCTACCCTTGG [A>G] CCCAGAGGTTCTTTGAGTCCTTTGG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWAQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Comments: The c.115A>G variant (CD 38 ACC>GCC) is a missense variant in the HBB gene predicted to cause substitution of threoning (ACC) to alanine (GCC) at position β 38(C4) Thr>Ala. It was first reported in a family with isolated low oxygen saturation (82-92%).

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70839
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: N/A
Molecular mechanism: N/A
Inheritance: Dominant
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Vega López L, Medina A, Gil-Peña H, Fonseca Mourelle A, Gutiérrez Martínez JR, Hemoglobin Oviedo (): A Cause of Low Oxygen Saturation., Hemoglobin, 48(3), 192-195, 2024
Created on 2024-10-29 15:54:35, Last reviewed on 2024-10-29 15:59:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.