IthaID: 4140

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 63 GCC>GGC [Ala>Gly] HGVS Name: HBA2:c.191C>G
Hb Name: Hb Guarda Protein Info: α2 63(E12) Ala>Gly
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GTTAAGGGCCACGGCAAGAAGGTGG [C>G] CGACGCGCTGACCAACGCCGTGGCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVGDALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: The c.191C>G [p.Ala64Gly] variant is located in exon 2 of the HBA2 gene. The heterozygous state is clinically asymptomatic. The Hb variant (HbX) was not separated by capillary electrophoresis or cation exchange HPLC; however, the abnormal HbX globin chain was isolated by reversed-phase HPLC, co-eluting just before the αA fraction.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34083
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Caucasian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Created on 2025-03-14 09:16:18, Last reviewed on 2025-03-14 09:17:27 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.