IthaID: 533

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 44 CCG>CTG [Pro>Leu] HGVS Name: HBA2:c.134C>T
Hb Name: Hb Milledgeville Protein Info: α2 44(CE2) Pro>Leu
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TTCCCCACCACCAAGACCTACTTCC [C/T] GCACTTCGACCTGAGCCACGGCTCT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFLHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34026
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African, French
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
216Hb Milledgevilleα2D-10Dual Kit Program5.81.44Heterozygous. Increased oxygen affinity leading to a mild erythrocytosis.[PDF]
217Hb Milledgevilleα2VARIANTβ-thal Short Program18.42.19Heterozygous. Increased oxygen affinity leading to a mild erythrocytosis.[PDF]
218Hb Milledgevilleα2VARIANT IIβ-thal Short Program22.32.26Heterozygous. Increased oxygen affinity leading to a mild erythrocytosis.[PDF]
219Hb Milledgevilleα2VARIANT IIDual Kit Program84.11.82Heterozygous. Increased oxygen affinity leading to a mild erythrocytosis.[PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Honig GR, Vida LN, Shamsuddin M, Mason RG, Schlumpf HW, Luke RA, Hemoglobin Milledgeville (alpha 44 (CD2) Pro leads to Leu): a new variant with increased oxygen affinity., Biochim. Biophys. Acta , 626(2), 424-31, 1980
  2. Hanss M, Lacan P, Aubry M, Lienhard A, Francina A, Thrombotic events in compound heterozygotes for a high affinity hemoglobin variant: Hb Milledgeville [alpha44(CE2)Pro-->Leu (alpha2)] and factor V Leiden., Hemoglobin , 26(3), 285-90, 2002
Created on 2010-06-16 16:13:15, Last reviewed on 2021-04-07 10:13:31 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.