IthaID: 588

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 64 GAC>AAC [Asp>Asn] HGVS Name: HBA2:c.193G>A
Hb Name: Hb G-Waimanalo Protein Info: α2 64(E13) Asp>Asn
Also known as: Hb Aida

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TAAGGGCCACGGCAAGAAGGTGGCC [G/A] ACGCGCTGACCAACGCCGTGGCGCA (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVANALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34085
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Filipino, Indian, Romanian, Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Blackwell RQ, Jim RT, Tan TG, Weng MI, Liu CS, Wang CL, Hemoglobin G Waimanalo: alpha-64 Asp leads to Asn., Biochim. Biophys. Acta , 322(1), 27-33, 1973
  2. Bunn HF, Altman AJ, Stangland K, Firshein SI, Forget B, Schmidt GJ, Jones RT, Hemoglobins Aida (alpha 64 Asp leads to Asn) and D-Los Angeles (beta 121 Glu leads to Gln) in an Asian-Indian family., Hemoglobin , 2(6), 531-40, 1978
  3. Baine RM, Wright JM, Wilkinson RW, HB G Waimanalo (alpha 64 Asp replaced by Asn) in a child with homozygous beta-thalassemia., Hemoglobin , 3(4), 293-8, 1979
  4. Harano T, Harano K, Ueda S, Shibata S, Imai K, Hemoglobin G Waimanalo [alpha 64 (E13) Asp replaced by Asn] in a Japanese. Hematologic, functional and synthesis studies., Hemoglobin , 5(6), 591-7, 1981
  5. Manca L, Masala B, Manca M, Ferranti P, Pucci P, Hb G-Waimanalo [alpha 64(E13)Asp-->Asn] observed in a Caucasian family., Hemoglobin , 18(1), 53-6, 1994
  6. Landin B, Berg P, Alpha 2-globin gene mutation Hb G-Waimanalo: occurrence in combination with alpha-thalassemia-1., Hemoglobin , 18(1), 71-2, 1994
Created on 2010-06-16 16:13:15, Last reviewed on 2022-07-08 13:42:11 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.