IthaID: 744

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 127 AAG>ACG [Lys>Thr] HGVS Name: HBA1:c.383A>C | HBA2:c.383A>C
Hb Name: Hb St. Claude Protein Info: α2 or α1 127(H10) Lys>Thr
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CCTGCGGTGCACGCCTCCCTGGACA [A/C] GTTCCTGGCTTCTGTGAGCACCGTG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDTFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34417 or 38228
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French, Canadian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
55Hb St. Claudeα1 or α2D-10Dual Kit Program21.81.42Heterozygous. Clinically normal. [PDF]
56Hb St. Claudeα1 or α2VARIANT IIβ-thal Short Program22.41.88Heterozygous. Clinically normal. [PDF]
57Hb St. Claudeα1 or α2VARIANT IIDual Kit Program22.11.49Heterozygous. Clinically normal. [PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Vella F, Galbraith P, Wilson JB, Wong SC, Folger GC, Huisman TJ, Hemoglobin St. Claude or alpha2-127(H10)Lys leads to Thr-beta2., Biochim. Biophys. Acta , 365(2), 318-22, 1974
Created on 2010-06-16 16:13:16, Last reviewed on 2014-04-15 09:48:43 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.