
IthaID: 744
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 127 AAG>ACG [Lys>Thr] | HGVS Name: | HBA1:c.383A>C | HBA2:c.383A>C |
| Hb Name: | Hb St. Claude | Protein Info: | α2 or α1 127(H10) Lys>Thr |
| Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CCTGCGGTGCACGCCTCCCTGGACA [A/C] GTTCCTGGCTTCTGTGAGCACCGTG (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDTFLASVSTVLTSKYR
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 34417 or 38228 |
| Size: | 1 bp or 1 bp |
| Located at: | α1 or α2 |
| Specific Location: | Exon 3 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | French, Canadian |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | No |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
| ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
|---|---|---|---|---|---|---|---|---|---|
| 55 | Hb St. Claude | α1 or α2 | D-10 | Dual Kit Program | 21.8 | 1.42 | Heterozygous. Clinically normal. | [PDF] | |
| 56 | Hb St. Claude | α1 or α2 | VARIANT II | β-thal Short Program | 22.4 | 1.88 | Heterozygous. Clinically normal. | [PDF] | |
| 57 | Hb St. Claude | α1 or α2 | VARIANT II | Dual Kit Program | 22.1 | 1.49 | Heterozygous. Clinically normal. | [PDF] |
In silico pathogenicity prediction
Publications / Origin
- Vella F, Galbraith P, Wilson JB, Wong SC, Folger GC, Huisman TJ, Hemoglobin St. Claude or alpha2-127(H10)Lys leads to Thr-beta2., Biochim. Biophys. Acta , 365(2), 318-22, 1974
Created on 2010-06-16 16:13:16,
Last reviewed on 2014-04-15 09:48:43 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.