
IthaID: 796
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
|---|---|---|---|
| Common Name: | CD 2 CAT>CCT [His>Pro] | HGVS Name: | HBB:c.8A>C |
| Hb Name: | Hb Marseille | Protein Info: | β 2(NA2) His>Pro |
| Also known as: | Hb Long Island-Marseille, Hb Agrigente |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
ACCTCAAACAGACACCATGGTGC [A/C] TCTGACTCCTGAGGAGAAGTCTG (Strand: -)
Protein sequence:
MVPLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Comments: Found in a 32-year old female in cis with the synonymous HBB:c.9T>C (CAT>CAC, [His>Pro]), which resulted in 1 amino-acid change from His to Pro.
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | β-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 70602 |
| Size: | 1 bp |
| Located at: | β |
| Specific Location: | Exon 1 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | American, Australian, French, Maltese, Sicilian, Chinese |
| Molecular mechanism: | Altered secondary structure |
| Inheritance: | Recessive |
| DNA Sequence Determined: | No |
In silico pathogenicity prediction
Publications / Origin
- Blouquit Y, Arous N, Lena D, Delanoe-Garin J, Lacombe C, Bardakdjian J, Vovan L, Orsini A, Rosa J, Galacteros F, Hb Marseille [alpha 2 beta 2 N methionyl-2 (NA2) His----Pro]: a new beta chain variant having an extended N-terminus., FEBS letters, 178(2), 315-8, 1984
- Boi S, Hendy J, Goodall I, Gilbert A, Fleming P, Hughes WG, First report of HB Long Island-Marseille in Australia--a chance discovery., Hemoglobin, 13(5), 515-20, 1989
- Wei L, Nan Y, Ying B, Zuoliang D, A Pitfall in HbA1c Testing Caused by Hb Long Island Hemoglobin Variant., Lab Med, 51(1), e1-e5, 2020
Created on 2010-06-16 16:13:16,
Last reviewed on 2021-10-25 13:45:52 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.