IthaID: 826

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 6 GAG>GCG HGVS Name: HBB:c.20A>C
Hb Name: Hb G-Makassar Protein Info: β 6(A3) Glu>Ala
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GACACCATGGTGCATCTGACTCCTG [A>C] GGAGAAGTCTGCCGTTACTGCCCTG (Strand: -)

Protein sequence:
MVHLTPAEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70614
Size: 1 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Indonesian, Thai, Malaysian
Molecular mechanism: Altered secondary structure
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Frequencies

Publications / Origin

  1. Blackwell RQ, Oemijati S, Pribadi W, Weng MI, Liu CS, Hemoglobin G Makassar: beta-6 Glu leads to Ala., Biochimica et biophysica acta, 214(3), 396-401, 1970
  2. Hamzah R, Mohamad AS, Mohd Yasin N, Esa E, Chen G, Selvaratnam V, The Characteristics of Compound Heterozygosity for Hemoglobin G-Makassar with Hb E in Malaysia., J Blood Med, 15(0), 255-264, 2024
Created on 2010-06-16 16:13:16, Last reviewed on 2025-08-14 11:59:40 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.