IthaID: 843

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 11 GTT>ATT HGVS Name: HBB:c.34G>A
Hb Name: Hb Hamilton Protein Info: β 11(A8) Val>Ile
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TCTGACTCCTGAGGAGAAGTCTGCC [A/G/T] TTACTGCCCTGTGGGGCAAGGTGAA (Strand: -)

Protein sequence:
MVHLTPEEKSAITALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70628
Size: 1 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Austrian | Chinese | Sardinian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
118Hb HamiltonβVARIANT IIβ-thal Short Program87.42.55Neutral variant, clinically normal. Elutes together with HbA on CE-HPLC. Abnormal chain could be observed by RP-HPLC. Diagnosis requires DNA studies.[PDF]
119Hb HamiltonβVARIANT IIDual Kit Program861.789Neutral variant, clinically normal. Elutes together with HbA on CE-HPLC. Abnormal chain could be observed by RP-HPLC. Diagnosis requires DNA studies.[PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Wong SC, Ali MA, Lam H, Webber BB, Wilson JB, Huisman TH, Hemoglobin Hamilton or alpha 2 beta 2 11(A8)Val leads to Ile: a silent beta-chain variant detected by Triton X-100 acid-urea polyacrylamide gel electrophoresis., American journal of hematology, 16(1), 47-52, 1984
Created on 2010-06-16 16:13:16, Last reviewed on 2013-10-15 17:00:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.