
IthaID: 873
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
|---|---|---|---|
| Common Name: | CD 22 GAA>CAA | HGVS Name: | HBB:c.67G>C |
| Hb Name: | Hb D-Iran | Protein Info: | β 22(B4) Glu>Gln |
| Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CCTGTGGGGCAAGGTGAACGTGGAT [A/C/G/T] AAGTTGGTGGTGAGGCCCTGGGCAG (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDQVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | β-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 70661 |
| Size: | 1 bp |
| Located at: | β |
| Specific Location: | Exon 1 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | N/A |
| Ethnic Origin: | Iranian | Italian | Jamaican | Pakistani |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
| ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
|---|---|---|---|---|---|---|---|---|---|
| 269 | Hb D-Iran | β | D-10 | Dual Kit Program | 14.3 | 2.59 | heterozygote | [PDF] | |
| 174 | Hb D-Iran | β | D-10 | Dual Kit Program | 45 | 2.64 | Carrier. Clinically normal. Elutes as HbA2 in CE-HPLC. Compound heterozygotes HbS/Hb D-Iran behave clinically as HbA/HbS. | [PDF] | |
| 270 | Hb D-Iran | β | VARIANT | β-thal Short Program | 38 | 3.56 | Heterozygous. Elutes as HbA2 in CE-HPLC. | [PDF] | |
| 175 | Hb D-Iran | β | VARIANT | β-thal Short Program | 40.3 | 3.55 | Carrier. Clinically normal. Elutes as HbA2 in CE-HPLC. Compound heterozygotes HbS/Hb D-Iran behave clinically as HbA/HbS. | [PDF] | |
| 272 | Hb D-Iran | β | VARIANT II | Dual Kit Program | 39 | 2.71 | Heterozygous. Elutes as HbA2 in CE-HPLC. | [PDF] | |
| 271 | Hb D-Iran | β | VARIANT II | β-thal Short Program | 38.7 | 3.54 | Heterozygous. Elutes as HbA2 in CE-HPLC. | [PDF] | |
| 177 | Hb D-Iran | β | VARIANT II | Dual Kit Program | 40.3 | 2.823 | Carrier. Clinically normal. Elutes as HbA2 in CE-HPLC. Compound heterozygotes HbS/Hb D-Iran behave clinically as HbA/HbS. | [PDF] | |
| 176 | Hb D-Iran | β | VARIANT II | β-thal Short Program | 40.4 | 3.56 | Carrier. Clinically normal. Elutes as HbA2 in CE-HPLC. Compound heterozygotes HbS/Hb D-Iran behave clinically as HbA/HbS. | [PDF] |
In silico pathogenicity prediction
Publications / Origin
- Rahbar S, Haemoglobin D Iran: 2 22 glutamic acid leads to glutamine (B4)., British journal of haematology, 24(1), 31-5, 1973
- Gupta A, Saraf A, Dass J, Mehta M, Radhakrishnan N, Saxena R, Bhargava M, Compound heterozygous hemoglobin d-punjab/hemoglobin d-iran: a novel hemoglobinopathy., Indian J Hematol Blood Transfus , 30(0), 409-12, 2014
Created on 2010-06-16 16:13:16,
Last reviewed on 2016-09-08 17:38:50 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.