IthaID: 1009



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 63 CAT>TAT HGVS Name: HBB:c.190C>T
Hb Name: Hb M-Saskatoon Protein Info: β 63(E7) His>Tyr
Also known as: Hb Hörlein-Weber, Hb Leipzig, Hb M-Arhus, Hb M-Chicago, Hb M-Emory, Hb M-Erlangen, Hb M-Hamburg, Hb M-Hida, Hb M-Kurume, Hb M-Radom, Hb Novi Sad

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TATGGGCAACCCTAAGGTGAAGGCT [C/T] ATGGCAAGAAAGTGCTCGGTGCCTT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAYGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:Methemoglobinaemia
Stability: Unstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70914
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Worldwide
Molecular mechanism: Altered heme pocket
Inheritance: Dominant
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
77 Hb M-Saskatoon β D-10 Dual Kit Program 6.9 4.7 Methemoglobinemia and unstable variant. [PDF]
78 Hb M-Saskatoon β VARIANT β-thal Short Program 9.3 4.91 Methemoglobinemia and unstable variant. [PDF]
79 Hb M-Saskatoon β VARIANT II β-thal Short Program 11.7 5 Methemoglobinemia and unstable variant. [PDF]
80 Hb M-Saskatoon β VARIANT II Dual Kit Program 4.4 4.51 Methemoglobinemia and unstable variant. [PDF]

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. GERALD PS, EFRON ML, Chemical studies of several varieties of Hb M., Proc. Natl. Acad. Sci. U.S.A. , 47(0), 1758-67, 1961 PubMed
  2. JOSEPHSON AM, WEINSTEIN HG, YAKULIS VJ, SINGER L, HELLER P, A new variant of hemoglobin M disease: hemoglobin M-Chicago., J. Lab. Clin. Med. , 59(0), 918-25, 1962 PubMed
  3. HOBOLTH N, HEMOGLOBIN MARHUS. I. CLINICAL FAMILY STUDY., Acta Paediatr Scand , 54(0), 355-62, 1965 PubMed
  4. Betke K, Kleihauer E, Gehring-Müller R, Braunitzer G, Jacobi J, Schmidt I, [HbM Hamburg, a beta chain anomaly: alpha-2-beta-2-63Tyr (equals HbM Saskatoon)]., Klin. Wochenschr. , 44(16), 961-6, 1966 PubMed
  5. Kedar PS, Nadkarni AH, Phanasgoankar S, Madkaikar M, Ghosh K, Gorakshakar AC, Colah RB, Mohanty D, Congenital methemoglobinemia caused by Hb-MRatnagiri (beta-63CAT-->TAT, His-->Tyr) in an Indian family., American journal of hematology, 79(2), 168-70, 2005 PubMed
  6. Iolascon A, Bianchi P, Andolfo I, Russo R, Barcellini W, Fermo E, Toldi G, Ghirardello S, Rees D, Van Wijk R, Kattamis A, Gallagher PG, Roy N, Taher A, Mohty R, Kulozik A, De Franceschi L, Gambale A, De Montalembert M, Forni GL, Harteveld CL, Prchal J, , Recommendations for diagnosis and treatment of methemoglobinemia., Am J Hematol, 96(12), 1666-1678, 2021 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2025-06-25 08:27:36 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.