IthaID: 1028



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 68 CTC>CCC [Leu>Pro] HGVS Name: HBB:c.206T>C
Hb Name: Hb Mizuho Protein Info: β 68(E12) Leu>Pro
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GTGAAGGCTCATGGCAAGAAAGTGC [T>C] CGGTGCCTTTAGTGATGGCCTGGCT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVPGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Comments: Unstable variant associated with severe hemolytic anemia in early childhood. It also exhibits slightly increased oxygen affinity. Although P50 values are uninformative, hemolysate exhibits a biphasic behavior at very low saturation values on the Hill plot, consistent with a high oxygen-affinity Hb exhibiting reduced cooperativity, and present in relatively small quantity [PMID: 2272836]. The insertion of a prolyl in the place of the leucyl residue at the β68 position (E12) in the middle of the Ε-helix disrupts the helix, thus affecting the tertiary structure of the β subunits. This position is next to the β67 (E11) valyl residue, which has an important hydrophobic contact with the heme moiety near the distal histine β63 (E7), thus the β68 Leu>Pro substitution may disturb the heme pocket.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70930
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Caucasian | Dutch | Italian | Japanese
Molecular mechanism: Altered secondary structure
Inheritance: Dominant
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Ohba Y, Miyaji T, Matsuoka M, Sugiyama K, Suzuki T, Sugiura T, Hemoglobin Mizuho or beta 68 (E 12) leucine leads to proline, a new unstable variant associated with severe hemolytic anemia., Hemoglobin, 1(5), 467-77, 1977 PubMed
  2. Labotka RJ, Vida LN, Honig GR, Hb Mizuho [beta 68(E12)Leu----Pro]. Second occurrence identified in a Caucasian child with hemolytic anemia and dense erythrocyte inclusions., Hemoglobin, 14(2), 129-36, 1990 PubMed
  3. Keeling MM, Bertolone SJ, Baysal E, Gu YC, Cepreganova B, Wilson JB, Huisman TH, Hb Mizuho or alpha 2 beta (2)68(E12)Leu----Pro in a Caucasian boy with high levels of Hb F; identification by sequencing of amplified DNA., Hemoglobin, 15(6), 477-85, 1991 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2023-02-22 16:55:59 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.