IthaID: 1040
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Benign / Likely Benign |
|---|---|---|---|
| Common Name: | CD 73 GAT>AAT | HGVS Name: | HBB:c.220G>A |
| Hb Name: | Hb G-Accra | Protein Info: | β 73(E17) Asp>Asn |
| Also known as: | Hb Korle-Bu |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CAAGAAAGTGCTCGGTGCCTTTAGT [A/G/T] ATGGCCTGGCTCACCTGGACAACCT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSNGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | β-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | Decreased Oxygen Affinity |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 70944 |
| Size: | 1 bp |
| Located at: | β |
| Specific Location: | Exon 2 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | N/A |
| Ethnic Origin: | African |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | No |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
| ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
|---|---|---|---|---|---|---|---|---|---|
| 384 | Hb G-Accra | β | D-10 | Dual Kit Program | 40.6 | 3.53 | Normal in the heterozygote. | [PDF] | |
| 385 | Hb G-Accra | β | VARIANT | β-thal Short Program | 43.9 | 3.88 | Normal in the heterozygote. | [PDF] | |
| 386 | Hb G-Accra | β | VARIANT II | β-thal Short Program | 43.5 | 3.89 | Normal in the heterozygote. | [PDF] | |
| 387 | Hb G-Accra | β | VARIANT II | Dual Kit Program | 43.1 | 3.144 | Normal in the heterozygote. | [PDF] |
In silico pathogenicity prediction
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Frequencies
Publications / Origin
- Konotey-Ahulu FI, Gallo E, Lehmann H, Ringelhann B, Haemoglobin Korle-Bu (beta 73 aspartic acid replaced by asparagine) showing one of the two amino acid substitutions of haemoglobin C Harlem., Journal of medical genetics, 5(2), 107-11, 1968 PubMed
- Nagel RL, Lin MJ, Witkowska HE, Fabry ME, Bestak M, Hirsch RE, Compound heterozygosity for hemoglobin C and Korle-Bu: moderate microcytic hemolytic anemia and acceleration of crystal formation [corrected]., Blood , 82(6), 1907-12, 1993 PubMed
Created on 2010-06-16 16:13:16,
Last reviewed on 2017-04-18 11:41:37 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.