IthaID: 1094



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 89 AGT>AGA or AGG [Ser>Arg] HGVS Name: HBB:c.270T>R
Hb Name: Hb Vanderbilt Protein Info: β 89(F5) Ser>Arg

Context nucleotide sequence:
AAGGGCACCTTTGCCACACTGAG [T>R] GAGCTGCACTGTGACAAGCTGCA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLRELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Replacement of serine with arginine at codon 89 leads to decreased sensitivity to 2,3-bisphosphoglyceric acid (2,3-BPG), possibly due to conformational change in its binding site, thereby increasing Hb affinity for oxygen.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70994
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Caucasian, Polish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Paniker NV, Lin KT, Krantz SB, Flexner JM, Wasserman BK, Puett D, Haemoglobin Vanderbilt (alpha2beta289Ser leads to Arg): a new haemoglobin with high oxygen affinity and compensatory erythrocytosis., British journal of haematology, 39(2), 249-58, 1978 PubMed
  2. Goodyer MJ, Elhassadi EI, Percy MJ, McMullin MF, A novel base change leading to Hb Vanderbilt [β89(F5)Ser→Arg, AGT>AGA]., Hemoglobin , 35(4), 428-9, 2011 PubMed
  3. Shomali W, Brar R, Arekapudi SR, Gotlib JR, A Kindred with a β-Globin Base Substitution [β89(F5)Ser→Arg (AG>AG); : c.270T>G] Resulting in Hemoglobin Vanderbilt., Hemoglobin, 43(0), 273-276, 2019 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2021-07-13 09:17:32 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.