IthaID: 1162
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 104 AGG>AGC [Arg>Ser] | HGVS Name: | HBB:c.315G>C |
Hb Name: | Hb Camperdown | Protein Info: | β 104(G6) Arg>Ser |
Context nucleotide sequence:
TGCACGTGGATCCTGAGAACTTCAG [G>C] GTGAGTCTATGGGACGCTTGATGTT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFSLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Initially reported in a Maltese family as an abnormal Hb by acetate cellulose electrophoresis. Protein analysis revealed substitution of arginine at position β104[G6] by a serine residue. The Hb variant is unstable and exhibits normal oxygen affinity at physiological pH in red cell suspensions, but has a lower oxygen affinity than HbA in chloride-free buffer. It moves more cathodically than HbA in citrate agar electrophoresis, an indication for a decrease in the number of positive charges in the protein usually associated with an abnormality at the β1β2 interface where anionic cofactors bind to tetrameric Hb. More information about the Hb variant impacton structure and biochemical properties are available at PMID 2606725. Molecular characterization in two unrelated individuals of Italian origin identified Hb Camperdown as an AGG>AGC change at position 104 (G6).
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 71039 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | N/A |
Ethnic Origin: | Maltese, Sicilian, Italian, Brazilian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
HPLC
ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
---|---|---|---|---|---|---|---|---|---|
449 | Hb Camperdown | β | VARIANT | β-thal Short Program | 45.9 | 1.29 | Hb variant is mildly unstable. | [PDF] | |
450 | Hb Camperdown | β | VARIANT II | β-thal Short Program | 43.1 | 1.34 | Hb variant is mildly unstable. | [PDF] | |
451 | Hb Camperdown | β | VARIANT II | Dual Kit Program | 45.5 | 0.958 | Hb variant is mildly unstable. | [PDF] | |
563 | Hb Camperdown | β | D-10 | Dual Kit Program | 46.7 | 0.68 | Mildly unstable. | [PDF] |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
- Wilkinson T, Chua CG, Carrell RW, Robin H, Exner T, Lee KM, Kronenberg H, Haemoglobin Camperdown beta104(G6) arginine leads to serine., Biochimica et biophysica acta, 393(1), 195-200, 1975 PubMed
- Kister J, Barbadjian J, Blouquit Y, Bohn B, Galacteros F, Poyart C, Inhibition of oxygen-linked anion binding in Hb Camperdown [alpha 2 beta 2(104)(G6)Arg----Ser]., Hemoglobin, 13(6), 567-78, 1989 PubMed
- Zhao W,Wilson JB,Huisman TH,Sciarratta GV,Ivaldi G,Petrini C,Ripamonti M, Hb Camperdown or alpha 2 beta 2(104)(G6)Arg----Ser in two Italian males., Hemoglobin, 4(4), 459-61, 1991 PubMed
- Jensen ON, Roepstorff P, Application of reversed phase high performance liquid chromatography and plasma desorption mass spectrometry for the characterization of a hemoglobin variant., Hemoglobin, 15(6), 497-507, 1991 PubMed
- Miranda SR,Kimura EM,Teixeira RC,Bertuzzo CS,Ramalho AS,Saad ST,Costa FF, Hb Camperdown [alpha 2 beta 2 104(G6)Arg-->Ser] identified by DNA analysis in a Brazilian family., Hemoglobin, 2(2), 147-53, 1996 PubMed
- Castelli R,Tempesta A,Bianchi A,Porro T,Ivaldi G,Cappellini MD, Unreliable estimation of HbA due to the presence of Camperdown haemoglobin [beta 104 (G6) Arg --> Ser]., Diabet Med, 4(4), 377-9, 2004 PubMed
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:16 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2021-03-09 16:04:24 | The IthaGenes Curation Team | Reviewed. Link added. |
4 | 2021-03-09 16:04:56 | The IthaGenes Curation Team | Reviewed. |
5 | 2021-03-09 16:05:22 | The IthaGenes Curation Team | Reviewed. |
6 | 2021-03-11 16:27:57 | The IthaGenes Curation Team | Reviewed. Links reviewed. |
7 | 2023-03-07 16:26:24 | The IthaGenes Curation Team | Reviewed. Links added |
8 | 2023-04-28 13:30:58 | The IthaGenes Curation Team | Reviewed. References and Comment added, Common and HGVS name corrected and Other fields updated |