IthaID: 1179



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 111 GTC>CTC, CD 119 GGC>GAC HGVS Name: HBB:c.[334G>C;359G>A]
Hb Name: Hb Fannin-Lubbock II Protein Info: β 111(G13) Val>Leu AND β 119(GH2) Gly>Asp

Context nucleotide sequence:
GTCTGTGTGCTGGCCCATCACTTTG [A/C/G/T] CAAAGAATTCACCCCACCAGTGCAG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLLCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71908
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: American | Mexican | Spanish
Molecular mechanism: Altered α1β1 interface
Inheritance: Recessive
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
153Hb Fannin-Lubbock IIβD-10Dual Kit Program341.54This variant carries in addition to the mutation of Hb Fannin Lubbock [Gly>Asp] a second neutral mutation [beta Val>Leu] which modifies the retention time in RP-HPLC. Clinically normal. [PDF]
154Hb Fannin-Lubbock IIβVARIANTβ-thal Short Program36.51.82This variant carries in addition to the mutation of Hb Fannin Lubbock [Gly>Asp] a second neutral mutation [beta Val>Leu] which modifies the retention time in RP-HPLC. Clinically normal. [PDF]
155Hb Fannin-Lubbock IIβVARIANT IIβ-thal Short Program36.11.91This variant carries in addition to the mutation of Hb Fannin Lubbock [Gly>Asp] a second neutral mutation [beta Val>Leu] which modifies the retention time in RP-HPLC. Clinically normal.[PDF]
156Hb Fannin-Lubbock IIβVARIANT IIDual Kit Program36.51.66This variant carries in addition to the mutation of Hb Fannin Lubbock [Gly>Asp] a second neutral mutation [beta Val>Leu] which modifies the retention time in RP-HPLC. Clinically normal.[PDF]

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Qin WB, Pobedimskaya DD, Molchanova TP, Wilson JB, Gu LH, de Pablos JM, Huisman TH, Hb Fannin-Lubbock in five Spanish families is characterized by two mutations: beta 111 GTC-->CTC (Val-->Leu) and beta 119 GGC-->GAC (Gly-->Asp)., Hemoglobin, 18(4), 297-306, 1994 PubMed
  2. González FA, Ropero P, Arrizabalaga B, García P, Cela E, Villegas A, [Fannin-Lubbock II hemoglobin [beta111(G13)Val -> Leu y beta119(GH2)Gly -> Asp]: description of 4 new cases]., Med Clin (Barc), 129(10), 379-81, 2007 PubMed
Created on 2010-06-16 16:13:17, Last reviewed on 2020-12-17 23:03:27 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.