IthaID: 1248



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 130 TAT>GAT HGVS Name: HBB:c.391T>G
Hb Name: Hb Wien Protein Info: β 130(H8) Tyr>Asp

Context nucleotide sequence:
ATTCACCCCACCAGTGCAGGCTGCC [G/T] ATCAGAAAGTGGTGGCTGGTGTGGC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAADQKVVAGVANALAHKYH

Also known as:

Comments: Position β130 (H8) is located at an internal site in the haemoglobin molecule at the base of the haem pocket. The Tyr>Asp substitution introduces a charged residue into the interior of the molecule where normally only uncharged residues can be accommodated, thus leading to instability. Associated with hemolytic anemia.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71965
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Australian, German
Molecular mechanism: N/A
Inheritance: Dominant
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Kleihauer E, Betke K, [Properties of the unstable Hb Wien], Klinische Wochenschrift, 50(19), 907-9, 1972 PubMed
  2. Lorkin PA, Pietschmann H, Braunsteiner H, Lehmann H, Structure of haemoglobin Wien beta 130 (H8) tyrosine-aspartic acid: an unstable haemoglobin variant., Acta Haematol, 51(6), 351-61, 1974 PubMed
  3. Hilbert S, Voill-Glaninger A, Höller B, Minkov M, Hemolytic anemia due to the unstable hemoglobin Wien: manifestations and long-term course in the largest pedigree identified to date., Haematologica, 105(5), e253-e255, 2020 PubMed
Created on 2010-06-16 16:13:17, Last reviewed on 2023-03-21 11:16:02 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.