
IthaID: 2023
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 117 TTC>TCC [Phe>Ser] | HGVS Name: | HBA2:c.353T>C |
Hb Name: | Hb Foggia | Protein Info: | α2 117(GH5) Phe>Ser |
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAESTPAVHASLDKFLASVSTVLTSKYR
Also known as:
Comments: Replacement of Phe residue at position α117 (GH5) by a charged arginine residue, which disrturbs the α1β1 contact and also impairs interaction with AHSP, thus leading to the α chain pool reduction and to the α-thalassemia phenotype. No unstable haemoglobins and no erythrocyte inclusion bodies have been documented. Detected in a family from Foggia, Southern Italy, with α-thalassemia haematologic phenotype (microcythemia).
External Links
No available links
Phenotype
Hemoglobinopathy Group: | Thalassaemia and Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-thalassaemia, α-chain variant |
Allele Phenotype: | α⁺ Thalassaemia |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | Haemolytic anaemia [HP:0001878] |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 34387 |
Size: | 1 bp |
Located at: | α2 |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Italian |
Molecular mechanism: | Altered α1β1 interface |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
Publications / Origin
- Lacerra G, Scarano C, Musollino G, Flagiello A, Pucci P, Carestia C., Hb Foggia or alpha 117(GH5)Phe -> Ser: a new alpha 2 globin allele affecting the alpha Hb-AHSP interaction., Haematologia, 93(1), 141-2, 2008
- Thom CS, Dickson CF, Gell DA, Weiss MJ, Hemoglobin variants: biochemical properties and clinical correlates., Cold Spring Harb Perspect Med, 3(3), a011858, 2013
Created on 2010-10-16 11:51:11,
Last reviewed on 2019-06-20 16:40:29 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-10-16 11:51:11 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2015-12-03 16:51:17 | The IthaGenes Curation Team | Reviewed. Phenotype updated |
4 | 2019-06-20 16:32:33 | The IthaGenes Curation Team | Reviewed. Comment, Protein Info and Reference added. Allele phenotype corrected. |
5 | 2019-06-20 16:34:11 | The IthaGenes Curation Team | Reviewed. |
6 | 2019-06-20 16:40:29 | The IthaGenes Curation Team | Reviewed. Comment updated. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2022-08-12 10:07:42