IthaID: 2297
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic | 
|---|---|---|---|
| Common Name: | CD 142 GCC>GTC (Ala>Val) | HGVS Name: | HBB:c.428C>T | 
| Hb Name: | Hb Waterland | Protein Info: | β 142 Ala>Val | 
| Also known as: | 
We follow the 
						 
							HGVS sequence variant nomenclature
						
						and
						 
							 IUPAC standards.
						
					
					
					
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALVHKYH
Comments: Found as a heterozygote with an alpha-thal 3.7 kb (type I) deletion. Patient was slightly microcytic but not anaemic. Mutation resulted in elevated oxygen affinity, while variant stability was normal with the heat test. Hb Waterland related to mild polycythemia.
External Links
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy | 
|---|---|
| Hemoglobinopathy Subgroup: | β-chain variant | 
| Allele Phenotype: | N/A | 
| Stability: | N/A | 
| Oxygen Affinity: | Increased Oxygen Affinity | 
| Associated Phenotypes: | N/A | 
Location
| Chromosome: | 11 | 
|---|---|
| Locus: | NG_000007.3 | 
| Locus Location: | 72002 | 
| Size: | 1 bp | 
| Located at: | β | 
| Specific Location: | Exon 3 | 
Other details
| Type of Mutation: | Point-Mutation(Substitution) | 
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) | 
| Ethnic Origin: | Iraqi | 
| Molecular mechanism: | N/A | 
| Inheritance: | Recessive | 
| DNA Sequence Determined: | Yes | 
In silico pathogenicity prediction
Sequence Viewer
								 Note:  The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
								Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
								In such a case, please Refresh the page or retry at a later stage.
								Otherwise, use this external link.
							
							
						Publications / Origin
- van Zwieten R, Veldthuis M, Delzenne B, Berghuis J, Groen J, Ait Ichou F, Clifford E, Harteveld CL, Stroobants AK, Hemoglobin Analyses in The Netherlands Reveal More Than 80 Different Variants Including Six Novel Ones., Hemoglobin , 2013 PubMed
 
					Created on 2014-01-08 12:29:03,
					Last reviewed on 2016-08-25 09:50:37					(Show full history)
				
				
			
 Disclaimer: The information on this website is provided as an information resource only
    and must not to be used as a substitute for professional diagnosis and treatment.
    The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
    diagnosis or any other information, services or products that an individual obtains through this website.