IthaID: 2316
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
|---|---|---|---|
| Common Name: | CD 114 CCC>GCC [Pro>Ala] | HGVS Name: | NM_000558.5(HBA1):c.343C>G |
| Hb Name: | Hb Broomhill | Protein Info: | α1 114(GH2) Pro>Ala |
Context nucleotide sequence:
GCTGGTGACCCTGGCCGCCCACCTC [C/G] CCGCCGAGTTCACCCCTGCGGTGCA (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLAAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as:
Comments: Found in a 72-year old male with a 15-year history of type 2 diabetes.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 38188 |
| Size: | 1 bp |
| Located at: | α1 |
| Specific Location: | Exon 3 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | Chinese |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- Yuan Yanping,Zhou Xianghai,Ren Qian,Ji Linong, Hb broomhill [α1 or α2 114(GH2) pro > ala;HBA1 or HBA2:c.343C > G]: a rare Hb variant found in a diabetic chinese individual., Scand J Clin Lab Invest, 7(7), 606-609, 2020
- Qin Danqing,Du Li,Wang Jicheng,Yao Cuize,Guo Hao,Yuan Tenglong,Liang Jie,Yin Aihua, Compound heterozygosity for hemoglobin variant Hb-Broomhill and the Southeast Asian α-thalassemia deletion does not worsen outcome: a case report of two unrelated patients., J Int Med Res, 11(11), 300060520967825, 2021
Created on 2014-01-10 14:07:17,
Last reviewed on 2024-04-12 12:00:02 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.