IthaID: 3271
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 119 CCT>GCT [Pro>Ala] | HGVS Name: | HBA2:c.358C>G |
Hb Name: | Hb Arcadia | Protein Info: | α2 119(H2) Pro>Ala |
Context nucleotide sequence:
TGGCCGCCCACCTCCCCGCCGAGTTCACC [C/G] CTGCGGTGCACGCCTCCCTGGACAAGTTC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTAAVHASLDKFLASVSTVLTSKYR
Also known as: Hb Lakeview Terrace
Comments: Co-inherited with SEA deletion, red cell indices are consistent with this finding. HPLC findings, appears as shoulder of Hb A peak (Primus Resolution). Recently, the variant reported in compound heterozygosity with Hb D-Los Angeles [IthaID: 1217] in a 11-month old infant presented with Hb 12.1 g/dL, MCH 24.1 pg, MCHC 33.8 g/dL, MCV 71.3 fL and RBC 5.02 10^12/L.
External Links
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 34392 |
Size: | 1 bp |
Located at: | α2 |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | N/A |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Daniel, Yvonne | 2017-10-26 | First report. |
2 | Monteiro, Daniel | 2017-10-26 | First report. |
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2017-10-26 14:31:13 | The IthaGenes Curation Team | Created |
2 | 2017-10-26 14:34:53 | The IthaGenes Curation Team | Reviewed. Location added. |
3 | 2017-10-27 12:04:39 | The IthaGenes Curation Team | Reviewed. Co-contributor added. |
4 | 2017-11-15 09:01:02 | The IthaGenes Curation Team | Reviewed. Hb name added. |
5 | 2021-02-02 16:36:34 | The IthaGenes Curation Team | Reviewed. Comment edit, Link added. |
6 | 2021-02-02 16:37:18 | The IthaGenes Curation Team | Reviewed. Protein info added. |