IthaID: 3322



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 28 CTG>ATG [Leu>Met] HGVS Name: HBG2:c.85C>A
Hb Name: Hb F-M Viseu Protein Info: Gγ 28(B10) Leu>Met
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Protein sequence:
MGHFTEEDKATITSLWGKVNVEDAGGETMGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Comments: Hb F-M Viseu associates with the methemoglobin (Met-Hb) phenotype. The mutation occurs in the γ-globin chain, hence the methaemoglobinaemia is transitory, resolving with the transition from fetal to adult haemoglobin. It was first reported in neonates with cyanosis.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: γ-chain variant
Allele Phenotype:Methemoglobinaemia
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 42972
Size: 1 bp
Located at:
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Spanish
Molecular mechanism: N/A
Inheritance: Dominant
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Bento C, Magalhães Maia T, Carvalhais I, Moita F, Abreu G, Relvas L, Pereira A, Farela Neves J, Ribeiro ML, Transient neonatal cyanosis associated with a new Hb F variant: Hb F viseu., J. Pediatr. Hematol. Oncol. , 35(2), e77-80, 2013 PubMed
  2. Carreira R, Palaré MJ, Prior AR, Garcia P, Abrantes M, An unusual cause of neonatal cyanosis…., BMJ Case Rep , 2015(0), , 2015 PubMed
Created on 2018-02-20 18:05:01, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.