IthaID: 3586



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 85 TTT>TTG [Phe>Leu] HGVS Name: HBB:c.258T>G
Hb Name: Hb Kennisis Protein Info: β 85(F1)Phe>Leu

Context nucleotide sequence:
CACCTGGACAACCTCAAGGGCACCTT [T>G] GCCACACTGAGTGAGCTGCACTGT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTLATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found in a heterozygous state in a 61-year-old Canadian male of Maltese descent presenting with high Hb concentration on routine blood work. Low p50 level suggestive of a high oxygen affinity Hb variant. Normal isopropanol and heat stability tests.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70982
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Maltese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Nabhani IA, Aneke JC, Verhovsek M, Eng B, Kuo KHM, Rudinskas LC, Waye JS, Novel High Oxygen Affinity Hemoglobin Variant in a Patient with Polycythemia: Hb Kennisis [β85(F1)Phe→Leu (TT>TT); : c.258T>G]., Hemoglobin, 2020 PubMed
Created on 2020-04-30 20:23:02, Last reviewed on 2020-04-30 20:23:45 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.