IthaID: 3597


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 26 (GAG>AAG); CD 104 (AGG>GGG) HGVS Name: HBB:c.[79G>A;313A>G]
Hb Name: Hb E-Gurdaspur Protein Info: β 26(B8) Glu>Lys AND β 104(G6) Arg>Gly

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGKALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFGLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: These two mutations were reported in an Indian woman presented with mild microcytosis mild hypochromia (Hb 12.1 g/dL, MCH 23.6 pg, MCV 72.1 Fl, RBC 5.11 10^12/L and Hb X 31.4 %).

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-thalassaemia, β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70673 or 71037
Size: 1 bp or 1 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Indian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Created on 2020-06-30 12:15:07, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.