IthaID: 3617

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 5 CCT>ACT [Pro>Thr] HGVS Name: HBD:c.16C>A
Hb Name: Hb A2-Partinico Protein Info: δ 5(A2)Pro>Thr
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
AGACACCATGGTGCATCTGACT [C>A] CTGAGGAGAAGACTGCTGTCAA (Strand: -)

Protein sequence:
MVHLTTEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Comments: Found in cis to the allele β+ thal IVS-I-110 G>A in five members of a Sicilian family. Detected by HPLC; overlaps HbA2 peak which is partially split. The residue 5(A2) of the δ-globin chain is in the alpha helix region; no functional alteration was predicted.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: δ-thalassaemia
Allele Phenotype:N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63198
Size: 1 bp
Located at: δ
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Italian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Lacerra G, Scarano C, Musollino G, Testa R, Prezioso R, Caruso DG, Lagona LF, Medulla E, Friscia MG, Gaudiano C, Carestia C, HbA2-Partinico or delta(A2)Pro-->Thr, a new genetic variation in the delta-globin gene in cis to the beta(+) thal IVS-I-110 G>A, and the heterogeneity of delta-globin alleles in double heterozygotes for beta- and delta-globin gene defects., Ann. Hematol., 89(2), 127-34, 2010
Created on 2020-09-07 14:40:21, Last reviewed on 2023-01-27 12:09:04 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.