IthaID: 3624

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 60 AAG>AGG [Lys>Arg] HGVS Name: HBA1:c.182A>G
Hb Name: Hb Liuzhou Protein Info: α1 60(E9) Lys>Arg
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGRKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Found in a 23-year-old Chinese woman with no clinical and haematological presentation.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:Silent Hb
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37878
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Xu A, Chen W, Xie W, Ji L, Identification of a new hemoglobin variant Hb Liuzhou [:C.182A→G] by MALDI-TOF mass spectrometry during HbA measurement., Scand. J. Clin. Lab. Invest., 2020
Created on 2020-09-08 11:20:32, Last reviewed on 2026-06-23 08:48:59 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.