
IthaID: 3718
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Benign / Likely Benign |
---|---|---|---|
Common Name: | CD 95 CCG>CTG [Pro>Leu] | HGVS Name: | HBA1:c.287C>T |
Hb Name: | Hb Georgia | Protein Info: | N/A |
Context nucleotide sequence:
TGCACGCGCACAAGCTTCGGGTGGACC [C/T] GGTCAACTTCAAGGTGAGCGGCGGGCC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDLVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as:
Comments: Found in three heterozygous clinically asymptomatic Malay cases presented with Hb range 11.7-14.8 g/dL, MCV 69.1-80.8 fL and MCH 24.5-26.8 pg. CE shows normal level of HbA2 and an abnormal peak (9.3-18%) at zone 7. HPLC shows no abnormal peak with normal Hb F level. The mutation also reported in compound heterozygosity with SEA deletion [IthaID: 309]. The patient presented with reduced Hb 8.0 g/dL, MCV 62.1 fL and MCH 19.3 pg. CE shows abnormal Hb 30.9 % at zone 7 and HbH 5 %. Normal level of HbF detected with HPLC.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 37983 |
Size: | 1 bp |
Located at: | α1 |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Malay |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Mohd Yasin, Norafiza | 2020-11-24 | First report. |
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2021-01-30 14:33:20 | The IthaGenes Curation Team | Created |
2 | 2021-01-30 14:35:29 | The IthaGenes Curation Team | Reviewed. Link added. |
3 | 2021-02-01 11:33:04 | The IthaGenes Curation Team | Reviewed. Protein sequence added. |