IthaID: 3875


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 74 GAC>GAG [Asp>Glu] HGVS Name: HBA1:c.225C>G
Hb Name: Hb Jishui Protein Info: α1 74(EF3) Asp>Glu

Context nucleotide sequence:
TGACCAACGCCGTGGCGCACGTGGA [C/G] GACATGCCCAACGCGCTGTCCGCCC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVEDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

Comments: Found in a 74-year-old Chinese male during the measurement of Hb A1c by a capillary electrophoresis method. However, analysis with the Hb program of CapillaryS3 TERA and the VARIANT II™ β-Thalassemia Short Program showed no indication of the Hb variant.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:α⁺
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37921
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Xie W, Zheng H, Xu A, Ji L, Hb Jishui [: c.225C>G, Codon 74 (>), Asp→Glu]: A Novel α Chain Hemoglobin Variant Detected During Hb A Measurement., Hemoglobin, 2021
Created on 2021-11-30 14:56:30, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.