IthaID: 3961
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 122/123 (-CG,+GA) | HGVS Name: | HBA2:c.369_370delinsGA |
| Hb Name: | Hb Nanning | Protein Info: | α2 122(H5) His>Gln and α2 123(H6) Ala>Thr |
| Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CCGCCGAGTTCACCCCTGCGGTGCA [CG/GA] GCCTCCCTGGACAAGTTCCTGGCTT (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVQASLDKFLASVSTVLTSKYR
Comments: The deletion/insertion causes the change of two amino acids in the H helix of the HBA2.The transition of histidine to glutamine at codon 122 and the transversion of alanine to threonine at codon 123, that have been reported in Hb Westmead [IthaID: 730] and Hb Santa Barnabas [IthaID: 731] respectively.
External Links
No available links
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 34403 |
| Size: | 2 bp |
| Located at: | α2 |
Other details
| Type of Mutation: | Insertion & Deletion |
|---|---|
| Ethnic Origin: | Chinese |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
- Chen B, Lin L, Yi S, Chen Q, Wei H, Li G, Zheng C, He S, Qiu X, A Novel Mutation of the α2-Globin Gene Causing α-Thalassemia: Hb Nanning (HBA2: c.369_370delinsGA)., Hemoglobin, 41(1), 56-58, 2017 PubMed
Created on 2022-08-17 10:20:47,
Last reviewed on 2022-08-17 10:24:39 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.