IthaID: 3989



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 20 CAC>CTC [His>Leu] HGVS Name: HBA2: c.62A>T
Hb Name: Hb Hebei Protein Info: N/A

Context nucleotide sequence:
GCCGCCTGGGGTAAGGTCGGCGCGC [A>T] CGCTGGCGAGTATGGTGCGGAGGCC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGALAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVHDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

Comments: Reported in a heterozygous state in a 34-year-old male with Hb 17.0 g/dL, MCV 84.1 fL, MCH 32.4 pg. No clinical presentation. Hb Hebei and Hb A cannot be separated using capillary 2 Flex Piercing device (Hb A 96.9%, Hb A2 3.1%). HPLC display a high value of P3 peak on the D100 instrument.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 33837
Size: 1 bp
Located at: α2
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Li WB, Zheng LH, Li YQ, Hb Hebei [α20 (B1) His→Leu; :C.62A > T]: A Novel Hemoglobin Variant Found during Measurement of Glycated Hemoglobin., Hemoglobin, 2024 PubMed

Microattributions

A/AContributor(s)DateComments
1Li, Youqiong2022-11-29First report.
Created on 2022-12-07 14:00:21, Last reviewed on 2024-02-22 13:22:04 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.