IthaID: 4069
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 46 GGG>AGG [Gly>Arg] | HGVS Name: | HBD:c.139G>A |
Hb Name: | Hb A2-Yulin | Protein Info: | N/A |
Context nucleotide sequence:
GGACCCAGAGGTTCTTTGAGTCCTTT [G>A] GGGATCTGTCCTCTCCTGATGCTGTT (Strand: -)
Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFRDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Also known as:
Comments: The HBD:c.139G>A variant was reported in a heterozygous state, along with β CD41/42 (-CTTT), in a 5-year-old Chinese girl [Hb 10.9 g/dL, RBC 5.76×1012/L, MCV 57.10 fL, MCH 18.90 pg]. Detected by Sanger sequencing. Capillary electrophoresis revealed splitting of the Hb A2 peak into two fractions (Hb A2 and Hb A2-Yulin) on the capillary 2 Flex Piercing device (Hb A 91.9% ,Hb F 4.0%, Hb A2 2.7%, Hb A2-Yulin 1.4%). The electrophoresis position of Hb A2-Yulin is located at Z1 zone.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
No available links
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | δ-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 63449 |
Size: | 1 bp |
Located at: | δ |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Chinese |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Li, Youqiong | 2023-08-30 | First report. |
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2023-09-27 14:50:38 | The IthaGenes Curation Team | Created |
2 | 2023-09-27 15:04:18 | The IthaGenes Curation Team | Reviewed. Location |